Original authors
Mirdita M, Schütze K, Moriwaki Y, Heo L, Ovchinnikov S & Steinegger M.
Plex is a simple client for computational biology applications. It uses distributed compute and storage to run containers on a public network.
Every file processed by Plex has a deterministic address based on its content, allowing you to keep track of your files and always share the right results with other scientists.
Run tools for small-molecule docking, protein design, etc.
Open source infrastructure—down to the bare metal
Powered by content addressing, each piece of your data has a unique ID. Track how your work is built upon from the moment it’s created.
{
"input": [
{
"name": "gp47_tail",
"sequence": "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV. RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC", "parameters": {
"max_template_date": "2022-01-01",
"mode": "monomer_single",
"weights_download_url": "https://storage.googleapis.com/alphafold/alphafold_params_2021-10-27.tar",
"db": "full",
"is_prokaryote": 0
}
}
]
}
